PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_15164
Common NameKK1_015602
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 375aa    MW: 42673.4 Da    PI: 7.8153
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_15164genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.1e-1864110148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd +l+++vkq+G + W+ Ia+++  gR +kqc++rw+++l
    C.cajan_15164  64 KGQWTDEEDRKLLKLVKQHGVRKWSQIAEKLD-GRAGKQCRERWHNHL 110
                      799*****************************.*************97 PP

2Myb_DNA-binding50.54.9e-16116158145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++W++eE+ +lv+ +++ G++ W+ Ia++++ gRt++ +k++w+
    C.cajan_15164 116 KDSWSEEEERILVESHAMIGNR-WAEIAKRIP-GRTENAIKNHWN 158
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.21159114IPR017930Myb domain
SuperFamilySSF466892.73E-3061157IPR009057Homeodomain-like
SMARTSM007177.8E-1763112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2865117IPR009057Homeodomain-like
PfamPF139211.3E-2067124No hitNo description
CDDcd001672.41E-1567110No hitNo description
PROSITE profilePS5129419.31115165IPR017930Myb domain
SMARTSM007177.3E-16115163IPR001005SANT/Myb domain
CDDcd001671.92E-11118161No hitNo description
Gene3DG3DSA:1.10.10.602.5E-20118163IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MWPNGITQEV SLVEQLLAND HEEALNWSQQ VPSLCLKDDV HVSGKKNFNV VGRRPKKGSV  60
PLIKGQWTDE EDRKLLKLVK QHGVRKWSQI AEKLDGRAGK QCRERWHNHL RPDIKKDSWS  120
EEEERILVES HAMIGNRWAE IAKRIPGRTE NAIKNHWNAT KRRQNSRRKN KRAATSNGKP  180
HSSILQDYIR TLTLTKTVTT PSIQQHHPKL SDSLSIDINY SSSPPLVAES YDDEMLFMQQ  240
LFKENNANVD ESLKHCSRNN SNNNSSASFV SCYDQSNDDG GGQILTDVSH CGFAHSNPNN  300
TNNVNSHNNI CLDESLFISR NPSYLDSDVC FSHLLNGTSG SSFCYNYGIH NQNMDMQQVN  360
DQDNWLQGKS GVCFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-45581641107B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160171KRRQNSRRKNKR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00567DAPTransfer from AT5G58850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003552966.11e-166PREDICTED: transcription factor MYB35-like
TrEMBLA0A151SZC50.0A0A151SZC5_CAJCA; Transcription factor MYB98
STRINGGLYMA18G07360.21e-166(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41293158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.17e-60myb domain protein 119